SCOPe 2.08: Domain d3kqgb1: 3kqg B:199-325

Lineage for d3kqgb1 (3kqg B:199-325)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d3kqgb1: 3kqg B:199-325 [199663]
   Other proteins in same PDB: d3kqga2, d3kqgb2, d3kqgc2, d3kqgd2, d3kqge2, d3kqgf2
   complexed with ca

Details for d3kqgb1

PDB Entry: 3kqg, 2.3 Å

PDB Description: trimeric structure of langerin

PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3kqgb1:

Sequence, based on SEQRES records:

>d3kqgb1 d.169.1.0 (B:199-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltka
gmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfi
ckrpyvp

Sequence, based on observed residues (ATOM records):

>d3kqgb1 d.169.1.0 (B:199-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltka
ggdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfick
rpyvp

Timeline for d3kqgb1:

• d3kqgb1 first appeared in SCOPe 2.03
  
• d3kqgb1 appears in SCOPe 2.07