Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) |
Domain d3kpse2: 3kps E:119-247 [199660] Other proteins in same PDB: d3kpsa1, d3kpsa2, d3kpsb_, d3kpsd1, d3kpse1 automated match to d1mi5e2 |
PDB Entry: 3kps (more details), 2.7 Å
SCOPe Domain Sequences for d3kpse2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpse2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d3kpse2: