SCOPe 2.03: Domain d3kpsa1: 3kps A:1-181

Lineage for d3kpsa1 (3kps A:1-181)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
   Uniprot P30481 25-300

8. Domain d3kpsa1: 3kps A:1-181 [199655]
   Other proteins in same PDB: d3kpsa2, d3kpsb_, d3kpsd1, d3kpsd2, d3kpse1, d3kpse2
   automated match to d1syva2

Details for d3kpsa1

PDB Entry: 3kps, 2.7 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylqafty a self peptide from the abcd3 protein

PDB Compounds: (A:) HLA class I histocompatibility antigen, B-44 alpha chain

SCOPe Domain Sequences for d3kpsa1:

Sequence; same for both SEQRES and ATOM records:

>d3kpsa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqdrayleglcveslrrylengketlq
r

Timeline for d3kpsa1:

• d3kpsa1 is new in SCOPe 2.03-stable
  
• d3kpsa1 appears in SCOPe 2.04
  
• d3kpsa1 appears in the current release, SCOPe 2.08