Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries) |
Domain d3kprj1: 3kpr J:3-118 [199653] Other proteins in same PDB: d3kpra1, d3kpra2, d3kprb_, d3kprd2, d3kpre2, d3kprf1, d3kprf2, d3kprg_, d3kpri2, d3kprj2 automated match to d1mi5e1 |
PDB Entry: 3kpr (more details), 2.6 Å
SCOPe Domain Sequences for d3kprj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kprj1 b.1.1.1 (J:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte
Timeline for d3kprj1: