Lineage for d3kprf2 (3kpr F:182-276)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358144Species Human (Homo sapiens) [TaxId:9606] [88605] (201 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2358422Domain d3kprf2: 3kpr F:182-276 [199650]
    Other proteins in same PDB: d3kpra1, d3kprb_, d3kprd1, d3kprd2, d3kpre1, d3kpre2, d3kprf1, d3kprg_, d3kpri1, d3kpri2, d3kprj1, d3kprj2
    automated match to d1syva1

Details for d3kprf2

PDB Entry: 3kpr (more details), 2.6 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylkawtf a mimotope
PDB Compounds: (F:) HLA class I histocompatibility antigen, B-44 alpha chain

SCOPe Domain Sequences for d3kprf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kprf2 b.1.1.2 (F:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpisdhevtlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d3kprf2:

Click to download the PDB-style file with coordinates for d3kprf2.
(The format of our PDB-style files is described here.)

Timeline for d3kprf2: