SCOPe 2.05: Domain d1cicb1: 1cic B:1-117

Lineage for d1cicb1 (1cic B:1-117)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1cicb1: 1cic B:1-117 [19965]
   Other proteins in same PDB: d1cica1, d1cica2, d1cicb2, d1cicc1, d1cicc2, d1cicd2
   part of D1.3 anti-idiotope Fab E225

Details for d1cicb1

PDB Entry: 1cic, 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225

PDB Compounds: (B:) protein (ig heavy chain v regions)

SCOPe Domain Sequences for d1cicb1:

Sequence; same for both SEQRES and ATOM records:

>d1cicb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgselvrpgasvklsckasgytftnywmhwvkqrpgqglewigniypgsgdsny
dekfkskatltvdtssstaymqlsgltsedsavyycarglafyfdhwgqgttltvss

Timeline for d1cicb1:

• d1cicb1 first appeared (with stable ids) in SCOP 1.55
  
• d1cicb1 appears in SCOPe 2.04
  
• d1cicb1 appears in SCOPe 2.06
  
• d1cicb1 appears in the current release, SCOPe 2.08