SCOPe 2.05: Domain d3kprf1: 3kpr F:1-181

Lineage for d3kprf1 (3kpr F:1-181)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
   Uniprot P30481 25-300

8. Domain d3kprf1: 3kpr F:1-181 [199649]
   Other proteins in same PDB: d3kpra2, d3kprb_, d3kprd1, d3kprd2, d3kpre1, d3kpre2, d3kprf2, d3kprg_, d3kpri1, d3kpri2, d3kprj1, d3kprj2
   automated match to d1syva2

Details for d3kprf1

PDB Entry: 3kpr, 2.6 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylkawtf a mimotope

PDB Compounds: (F:) HLA class I histocompatibility antigen, B-44 alpha chain

SCOPe Domain Sequences for d3kprf1:

Sequence; same for both SEQRES and ATOM records:

>d3kprf1 d.19.1.1 (F:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqdrayleglcveslrrylengketlq
r

Timeline for d3kprf1:

• d3kprf1 first appeared in SCOPe 2.03
  
• d3kprf1 appears in SCOPe 2.04
  
• d3kprf1 appears in SCOPe 2.06
  
• d3kprf1 appears in the current release, SCOPe 2.08