Lineage for d3kppa1 (3kpp A:1-181)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1642091Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
    Uniprot P30481 25-300
  8. 1642098Domain d3kppa1: 3kpp A:1-181 [199639]
    Other proteins in same PDB: d3kppa2, d3kppb_
    automated match to d1syva2
    complexed with peg

Details for d3kppa1

PDB Entry: 3kpp (more details), 1.9 Å

PDB Description: crystal structure of hla b*4405 in complex with eeylqafty a self peptide from the abcd3 protein
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-44 alpha chain

SCOPe Domain Sequences for d3kppa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kppa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqdrayleglcveslrrylengketlq
r

SCOPe Domain Coordinates for d3kppa1:

Click to download the PDB-style file with coordinates for d3kppa1.
(The format of our PDB-style files is described here.)

Timeline for d3kppa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kppa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3kppb_