Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries) Uniprot P30481 25-300 |
Domain d3kpoa1: 3kpo A:1-181 [199637] Other proteins in same PDB: d3kpoa2, d3kpob1, d3kpob2 automated match to d1n2ra2 |
PDB Entry: 3kpo (more details), 2.3 Å
SCOPe Domain Sequences for d3kpoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpoa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]} gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqdaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcveslrrylengketlq r
Timeline for d3kpoa1: