SCOPe 2.05: Domain d3kpoa1: 3kpo A:1-181

Lineage for d3kpoa1 (3kpo A:1-181)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
   Uniprot P30481 25-300

8. Domain d3kpoa1: 3kpo A:1-181 [199637]
   Other proteins in same PDB: d3kpoa2, d3kpob_
   automated match to d1n2ra2

Details for d3kpoa1

PDB Entry: 3kpo, 2.3 Å

PDB Description: crystal structure of hla b*4403 in complex with eeylkawtf, a mimotope

PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d3kpoa1:

Sequence; same for both SEQRES and ATOM records:

>d3kpoa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcveslrrylengketlq
r

Timeline for d3kpoa1:

• d3kpoa1 first appeared in SCOPe 2.03
  
• d3kpoa1 appears in SCOPe 2.04
  
• d3kpoa1 appears in SCOPe 2.06
  
• d3kpoa1 appears in the current release, SCOPe 2.08