Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (213 PDB entries) Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor |
Domain d1cicc1: 1cic C:1-107 [19962] Other proteins in same PDB: d1cica2, d1cicb1, d1cicb2, d1cicc2, d1cicd1, d1cicd2 part of Fab D1.3 |
PDB Entry: 1cic (more details), 2.5 Å
SCOPe Domain Sequences for d1cicc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cicc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtklelk
Timeline for d1cicc1: