Lineage for d3k9xc1 (3k9x C:94-126)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459896Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1459897Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1460327Protein automated matches [190092] (1 species)
    not a true protein
  7. 1460328Species Human (Homo sapiens) [TaxId:9606] [187310] (65 PDB entries)
  8. 1460357Domain d3k9xc1: 3k9x C:94-126 [199614]
    Other proteins in same PDB: d3k9xb_, d3k9xd_
    automated match to d1xkal1
    complexed with ca, gol, mbm, na

Details for d3k9xc1

PDB Entry: 3k9x (more details), 1.9 Å

PDB Description: x-ray crystal structure of human fxa in complex with (s)-n-((2- methylbenzofuran-5-ylamino)(2-oxo-1-(2-oxo-2- (pyrrolidin-1-yl) ethyl)azepan-3- ylamino)methylene)nicotinamide
PDB Compounds: (C:) protein (coagulation factor x)

SCOPe Domain Sequences for d3k9xc1:

Sequence, based on SEQRES records: (download)

>d3k9xc1 g.3.11.1 (C:94-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcqnqgkckdglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records): (download)

>d3k9xc1 g.3.11.1 (C:94-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcqnqgkckdytctclegfegkncelftr

SCOPe Domain Coordinates for d3k9xc1:

Click to download the PDB-style file with coordinates for d3k9xc1.
(The format of our PDB-style files is described here.)

Timeline for d3k9xc1: