SCOPe 2.04: Domain d3k9xa1: 3k9x A:90-126

Lineage for d3k9xa1 (3k9x A:90-126)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (66 PDB entries)

8. Domain d3k9xa1: 3k9x A:90-126 [199611]
   Other proteins in same PDB: d3k9xb_, d3k9xd_
   automated match to d1xkal1
   complexed with ca, gol, mbm, na

Details for d3k9xa1

PDB Entry: 3k9x, 1.9 Å

PDB Description: x-ray crystal structure of human fxa in complex with (s)-n-((2- methylbenzofuran-5-ylamino)(2-oxo-1-(2-oxo-2- (pyrrolidin-1-yl) ethyl)azepan-3- ylamino)methylene)nicotinamide

PDB Compounds: (A:) protein (coagulation factor x)

SCOPe Domain Sequences for d3k9xa1:

Sequence, based on SEQRES records:

>d3k9xa1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cetspcqnqgkckdglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records):

>d3k9xa1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cetspcqnqgkckdeytctclegfegkncelftr

Timeline for d3k9xa1:

• d3k9xa1 first appeared in SCOPe 2.03
  
• d3k9xa1 appears in SCOPe 2.05
  
• d3k9xa1 appears in the current release, SCOPe 2.08