SCOPe 2.02: Domain d1fdlh1: 1fdl H:1-116

Lineage for d1fdlh1 (1fdl H:1-116)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)

8. Domain d1fdlh1: 1fdl H:1-116 [19961]
   Other proteins in same PDB: d1fdlh2, d1fdll1, d1fdll2, d1fdly_
   part of Fab D1.3

Details for d1fdlh1

PDB Entry: 1fdl, 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

PDB Compounds: (H:) igg1-kappa d1.3 fab (heavy chain)

SCOPe Domain Sequences for d1fdlh1:

Sequence; same for both SEQRES and ATOM records:

>d1fdlh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss

Timeline for d1fdlh1:

• d1fdlh1 first appeared (with stable ids) in SCOP 1.55
  
• d1fdlh1 appears in SCOPe 2.01
  
• d1fdlh1 appears in SCOPe 2.03
  
• d1fdlh1 appears in the current release, SCOPe 2.08