Lineage for d1fdlh1 (1fdl H:1-116)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102604Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)
  8. 102639Domain d1fdlh1: 1fdl H:1-116 [19961]
    Other proteins in same PDB: d1fdlh2, d1fdll2, d1fdly_

Details for d1fdlh1

PDB Entry: 1fdl (more details), 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdlh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdlh1 b.1.1.1 (H:1-116) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss

SCOP Domain Coordinates for d1fdlh1:

Click to download the PDB-style file with coordinates for d1fdlh1.
(The format of our PDB-style files is described here.)

Timeline for d1fdlh1: