![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries) |
![]() | Domain d1fdlh1: 1fdl H:1-116 [19961] Other proteins in same PDB: d1fdlh2, d1fdll2, d1fdly_ |
PDB Entry: 1fdl (more details), 2.5 Å
SCOP Domain Sequences for d1fdlh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdlh1 b.1.1.1 (H:1-116) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain} qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss
Timeline for d1fdlh1: