Class g: Small proteins [56992] (90 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein automated matches [226950] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225942] (2 PDB entries) |
Domain d3k65a_: 3k65 A: [199609] Other proteins in same PDB: d3k65b_ automated match to d1a0ha1 complexed with bu1 |
PDB Entry: 3k65 (more details), 1.85 Å
SCOPe Domain Sequences for d3k65a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k65a_ g.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcvpdrgqqyqgrlavtthglpclawasaqakalskhqdfnsavqlvenfcrnpdgdeeg vwcyvagkpgdfgycdlnyc
Timeline for d3k65a_: