Lineage for d1fdll1 (1fdl L:1-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158080Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)
  8. 158116Domain d1fdll1: 1fdl L:1-107 [19960]
    Other proteins in same PDB: d1fdlh2, d1fdll2, d1fdly_

Details for d1fdll1

PDB Entry: 1fdl (more details), 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdll1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleik

SCOP Domain Coordinates for d1fdll1:

Click to download the PDB-style file with coordinates for d1fdll1.
(The format of our PDB-style files is described here.)

Timeline for d1fdll1: