Lineage for d3k0ta_ (3k0t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2959017Species Pseudomonas syringae [TaxId:323] [196440] (1 PDB entry)
  8. 2959018Domain d3k0ta_: 3k0t A: [199599]
    automated match to d3k0tc_
    complexed with bgc

Details for d3k0ta_

PDB Entry: 3k0t (more details), 2.1 Å

PDB Description: crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000
PDB Compounds: (A:) Endoribonuclease L-PSP, putative

SCOPe Domain Sequences for d3k0ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k0ta_ d.79.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 323]}
ktvitsdkapaaigpysqaikagntvymsgqipldpstmelvegieaqitqvfenlksva
qaaggsfkdivklnifltdlghfakvneimgsyfsqpyparaaigvaalprgaqvemdai
lvi

SCOPe Domain Coordinates for d3k0ta_:

Click to download the PDB-style file with coordinates for d3k0ta_.
(The format of our PDB-style files is described here.)

Timeline for d3k0ta_: