SCOPe 2.03: Domain d3jwqc_: 3jwq C:

Lineage for d3jwqc_ (3jwq C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (22 PDB entries)

8. Domain d3jwqc_: 3jwq C: [199595]
   automated match to d3jwrb_
   complexed with mg, via, zn

Details for d3jwqc_

PDB Entry: 3jwq, 2.87 Å

PDB Description: crystal structure of chimeric pde5/pde6 catalytic domain complexed with sildenafil

PDB Compounds: (C:) cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera

SCOPe Domain Sequences for d3jwqc_:

Sequence; same for both SEQRES and ATOM records:

>d3jwqc_ a.211.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkh
evlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaals
hdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeyktt
lkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpw
piqqriaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlyeal
thvsedcfplldgcrknrqkwqalaeq

Timeline for d3jwqc_:

• d3jwqc_ is new in SCOPe 2.03-stable
  
• d3jwqc_ appears in SCOPe 2.04
  
• d3jwqc_ appears in the current release, SCOPe 2.08, called d3jwqc1