Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein automated matches [190370] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries) |
Domain d3jwqa_: 3jwq A: [199593] Other proteins in same PDB: d3jwqc2 automated match to d3jwrb_ complexed with mg, via, zn |
PDB Entry: 3jwq (more details), 2.87 Å
SCOPe Domain Sequences for d3jwqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwqa_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl dhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlki ikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiq qriaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlyealthv sedcfplldgcrknrqkwqalaeq
Timeline for d3jwqa_:
View in 3D Domains from other chains: (mouse over for more information) d3jwqb_, d3jwqc1, d3jwqc2, d3jwqd_ |