Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (19 PDB entries) |
Domain d3jvga2: 3jvg A:181-276 [199590] Other proteins in same PDB: d3jvga1, d3jvga3, d3jvgb1, d3jvgb3 automated match to d1gzqa1 complexed with cl, nag, unl |
PDB Entry: 3jvg (more details), 2.2 Å
SCOPe Domain Sequences for d3jvga2:
Sequence, based on SEQRES records: (download)
>d3jvga2 b.1.1.0 (A:181-276) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} qvppmavvfartagqaqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadl tyqlrstllvspqdghgyacrvqhcslgdrsllvpw
>d3jvga2 b.1.1.0 (A:181-276) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} qvppmavvfartaqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadltyq lrstllvsphgyacrvqhcslgrsllvpw
Timeline for d3jvga2: