SCOP 1.73: Domain d1g7la_: 1g7l A:

Lineage for d1g7la_ (1g7l A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1g7la_: 1g7l A: [19958]
   Other proteins in same PDB: d1g7lb_, d1g7lc_
   part of Fv D1.3
   mutant

Details for d1g7la_

PDB Entry: 1g7l, 2 Å

PDB Description: crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3 (vlw92s)

PDB Compounds: (A:) anti-hen egg white lysozyme monoclonal antibody d1.3

SCOP Domain Sequences for d1g7la_:

Sequence; same for both SEQRES and ATOM records:

>d1g7la_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfsstprtfgggtkleik

Timeline for d1g7la_:

• d1g7la_ first appeared (with stable ids) in SCOP 1.55
  
• d1g7la_ appears in SCOP 1.71
  
• d1g7la_ appears in SCOP 1.75
  
• d1g7la_ appears in the current release, SCOPe 2.08