Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries) |
Domain d3ilqc1: 3ilq C:7-185 [199551] Other proteins in same PDB: d3ilqc2, d3ilqd_ automated match to d1onqa2 complexed with 1o2, nag |
PDB Entry: 3ilq (more details), 2.05 Å
SCOPe Domain Sequences for d3ilqc1:
Sequence, based on SEQRES records: (download)
>d3ilqc1 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
>d3ilqc1 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemyasesflhvafqgkyvvrfw gtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3ilqc1: