Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d3ilpa2: 3ilp A:186-279 [199550] Other proteins in same PDB: d3ilpa1, d3ilpb_ automated match to d1onqa1 complexed with 1l2, dms, nag |
PDB Entry: 3ilp (more details), 1.85 Å
SCOPe Domain Sequences for d3ilpa2:
Sequence, based on SEQRES records: (download)
>d3ilpa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssadghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
>d3ilpa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssaghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwy lqatldveageeaglacrvkhsslggqdiilyw
Timeline for d3ilpa2: