Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein HIV-1 reverse transcriptase [56689] (3 species) |
Species Hiv-1 m:b_hxb2r [TaxId:11706] [190022] (22 PDB entries) |
Domain d3i0sa1: 3i0s A:0-429 [199538] Other proteins in same PDB: d3i0sa2 automated match to d1bqna2 protein/DNA complex; protein/RNA complex; complexed with rt7 |
PDB Entry: 3i0s (more details), 2.7 Å
SCOPe Domain Sequences for d3i0sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i0sa1 e.8.1.2 (A:0-429) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]} spispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntp vfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvp ldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiv iyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkw tvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteea elelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrg ahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvnt pplvklwyql
Timeline for d3i0sa1: