Lineage for d3huje2 (3huj E:118-206)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294630Domain d3huje2: 3huj E:118-206 [199529]
    Other proteins in same PDB: d3huja1, d3huja2, d3hujb_, d3hujc1, d3hujc2, d3hujd_, d3huje1, d3hujf1, d3hujg1, d3hujh1
    automated match to d1qrnd2
    complexed with agh, mg, nag, ndg

Details for d3huje2

PDB Entry: 3huj (more details), 2.5 Å

PDB Description: crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
PDB Compounds: (E:) NKT15 T cell receptor alpha-chain

SCOPe Domain Sequences for d3huje2:

Sequence, based on SEQRES records: (download)

>d3huje2 b.1.1.2 (E:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d3huje2 b.1.1.2 (E:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdssdkvclftdfdsqtnvsqsdsdvyitdkcvldmrsmdfksnsavaw
snksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3huje2:

Click to download the PDB-style file with coordinates for d3huje2.
(The format of our PDB-style files is described here.)

Timeline for d3huje2: