Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (5 species) |
Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries) |
Domain d3huja2: 3huj A:184-280 [199525] Other proteins in same PDB: d3huja1, d3hujb_, d3hujc1, d3hujd_, d3huje1, d3huje2, d3hujf1, d3hujf2, d3hujg1, d3hujg2, d3hujh1, d3hujh2 automated match to d1onqa1 complexed with agh, mg, nag, ndg |
PDB Entry: 3huj (more details), 2.5 Å
SCOPe Domain Sequences for d3huja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3huja2 b.1.1.2 (A:184-280) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw ylratldvvageaaglscrvkhsslegqdivlywhhh
Timeline for d3huja2: