Lineage for d3hpta1 (3hpt A:90-126)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258598Protein automated matches [190092] (2 species)
    not a true protein
  7. 2258599Species Human (Homo sapiens) [TaxId:9606] [187310] (80 PDB entries)
  8. 2258648Domain d3hpta1: 3hpt A:90-126 [199518]
    Other proteins in same PDB: d3hptb_, d3hptd_
    automated match to d1xkal1
    complexed with act, ca, dms, gol, mes, na, yet

Details for d3hpta1

PDB Entry: 3hpt (more details), 2.19 Å

PDB Description: crystal structure of human fxa in complex with (s)-2-cyano-1-(2- methylbenzofuran-5-yl)-3-(2-oxo-1-(2-oxo-2-(pyrrolidin-1-yl)ethyl) azepan-3-yl)guanidine
PDB Compounds: (A:) coagulation factor x

SCOPe Domain Sequences for d3hpta1:

Sequence, based on SEQRES records: (download)

>d3hpta1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cetspcqnqgkckdglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records): (download)

>d3hpta1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cspcqnqgkckdeytctclegfegkncelftr

SCOPe Domain Coordinates for d3hpta1:

Click to download the PDB-style file with coordinates for d3hpta1.
(The format of our PDB-style files is described here.)

Timeline for d3hpta1: