SCOP 1.57: Domain d1a7pl_: 1a7p L:

Lineage for d1a7pl_ (1a7p L:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)

8. Domain d1a7pl_: 1a7p L: [19950]

Details for d1a7pl_

PDB Entry: 1a7p, 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) engineered mutant pro95l->ser on variant chain l glu81->asp and chain h leu312->val

SCOP Domain Sequences for d1a7pl_:

Sequence; same for both SEQRES and ATOM records:

>d1a7pl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpddfgsyycqhfwstsrtfgggtkleik

Timeline for d1a7pl_:

• d1a7pl_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7pl_ appears in SCOP 1.59
  
• d1a7pl_ appears in the current release, SCOPe 2.08