Lineage for d3he6a2 (3he6 A:186-280)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035181Domain d3he6a2: 3he6 A:186-280 [199498]
    Other proteins in same PDB: d3he6a1, d3he6a3, d3he6b_, d3he6c2, d3he6d2
    automated match to d1gzqa1
    complexed with agh, nag

Details for d3he6a2

PDB Entry: 3he6 (more details), 2.9 Å

PDB Description: crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta8.2 nkt tcr
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3he6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3he6a2 b.1.1.0 (A:186-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilywg

SCOPe Domain Coordinates for d3he6a2:

Click to download the PDB-style file with coordinates for d3he6a2.
(The format of our PDB-style files is described here.)

Timeline for d3he6a2: