Lineage for d3hd5a1 (3hd5 A:28-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879277Species Bordetella parapertussis [TaxId:519] [196569] (1 PDB entry)
  8. 2879278Domain d3hd5a1: 3hd5 A:28-208 [199495]
    Other proteins in same PDB: d3hd5a2, d3hd5b2, d3hd5c2
    automated match to d3hd5c_

Details for d3hd5a1

PDB Entry: 3hd5 (more details), 2.35 Å

PDB Description: crystal structure of a thiol:disulfide interchange protein dsba from bordetella parapertussis
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3hd5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hd5a1 c.47.1.0 (A:28-208) automated matches {Bordetella parapertussis [TaxId: 519]}
qgaqqyvninppmpsdtpgkievleffaytcphcaaiepmvedwaktapqdvvlkqvpia
fnagmkplqqlyytlqalerpdlhpkvftaihterkrlfdkkamgewaasqgvdrakfds
vfdsfsvqtqvqrasqlaeaahidgtpafavggrymtspvlagndyagalkvvdqlivqs
r

SCOPe Domain Coordinates for d3hd5a1:

Click to download the PDB-style file with coordinates for d3hd5a1.
(The format of our PDB-style files is described here.)

Timeline for d3hd5a1: