SCOPe 2.06: Domain d3hb3b1: 3hb3 B:1-107

Lineage for d3hb3b1 (3hb3 B:1-107)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [81456] (4 PDB entries)

8. Domain d3hb3b1: 3hb3 B:1-107 [199493]
   Other proteins in same PDB: d3hb3a_, d3hb3b2, d3hb3c_, d3hb3d_
   automated match to d1ar1b2
   complexed with ca, cu1, hea, lda, lmt, mn, peo

Details for d3hb3b1

PDB Entry: 3hb3, 2.25 Å

PDB Description: High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3hb3b1:

Sequence; same for both SEQRES and ATOM records:

>d3hb3b1 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

Timeline for d3hb3b1:

• d3hb3b1 first appeared in SCOPe 2.03
  
• d3hb3b1 appears in SCOPe 2.05
  
• d3hb3b1 appears in SCOPe 2.07
  
• d3hb3b1 appears in the current release, SCOPe 2.08