Class a: All alpha proteins [46456] (286 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) |
Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
Protein automated matches [226863] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries) |
Domain d3h2vd_: 3h2v D: [199491] Other proteins in same PDB: d3h2ve_, d3h2vf_, d3h2vg_, d3h2vh_ automated match to d1qkrb_ protein/RNA complex |
PDB Entry: 3h2v (more details), 2.9 Å
SCOPe Domain Sequences for d3h2vd_:
Sequence, based on SEQRES records: (download)
>d3h2vd_ a.24.9.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} efpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsgt kraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvka tmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktp
>d3h2vd_ a.24.9.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} efpevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsgtkrali qcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgr tnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktp
Timeline for d3h2vd_: