SCOPe 2.03: Domain d3h2vb_: 3h2v B:

Lineage for d3h2vb_ (3h2v B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein automated matches [226863] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries)

8. Domain d3h2vb_: 3h2v B: [199489]
   Other proteins in same PDB: d3h2ve_, d3h2vf_, d3h2vg_, d3h2vh_
   automated match to d1qkrb_
   protein/RNA complex

Details for d3h2vb_

PDB Entry: 3h2v, 2.9 Å

PDB Description: Human raver1 RRM1 domain in complex with human vinculin tail domain Vt

PDB Compounds: (B:) vinculin

SCOPe Domain Sequences for d3h2vb_:

Sequence, based on SEQRES records:

>d3h2vb_ a.24.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsgt
kraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvka
tmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktp

Sequence, based on observed residues (ATOM records):

>d3h2vb_ a.24.9.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efpeevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsgtkral
iqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlg
rtnisdeeseqatemlvhnaqnlmqsvketvreaeaastlrwvrktp

Timeline for d3h2vb_:

• d3h2vb_ is new in SCOPe 2.03-stable
  
• d3h2vb_ appears in SCOPe 2.04
  
• d3h2vb_ appears in the current release, SCOPe 2.08