Lineage for d1g7ha_ (1g7h A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288098Domain d1g7ha_: 1g7h A: [19948]
    Other proteins in same PDB: d1g7hb_, d1g7hc_
    part of Fv D1.3
    mutant

Details for d1g7ha_

PDB Entry: 1g7h (more details), 1.85 Å

PDB Description: crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3(vlw92a)

SCOP Domain Sequences for d1g7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ha_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfastprtfgggtkleik

SCOP Domain Coordinates for d1g7ha_:

Click to download the PDB-style file with coordinates for d1g7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1g7ha_: