Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Salmonella typhimurium [TaxId:602] [196582] (1 PDB entry) |
Domain d3h02c_: 3h02 C: [199479] automated match to d3t89f_ complexed with bct, so4 |
PDB Entry: 3h02 (more details), 2.15 Å
SCOPe Domain Sequences for d3h02c_:
Sequence, based on SEQRES records: (download)
>d3h02c_ c.14.1.0 (C:) automated matches {Salmonella typhimurium [TaxId: 602]} detmlyapvewhdcsegytdiryekstdgiakitinrpqvrnafrpltvkemiqaladar yddnvgviiltgegdkafcaggdqkvrgdyggyqddsgvhhlnvldfqrqirtcpkpvva mvagysiggghvlhmmcdltiaaenaifgqtgpkvgsfdggwgasymarivgqkkareiw flcrqydaqqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa glqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
>d3h02c_ c.14.1.0 (C:) automated matches {Salmonella typhimurium [TaxId: 602]} detmlyapvewhdcsegytdiryekstdgiakitinrpqvrnafrpltvkemiqaladar yddnvgviiltgegdkafcagglnvldfqrqirtcpkpvvamvagysiggghvlhmmcdl tiaaenaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydaqqaldmglvnt vvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymteeg qegrnafnqkrqpdfskfkrnp
Timeline for d3h02c_: