Lineage for d3gsva1 (3gsv A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545619Protein automated matches [191280] (6 species)
    not a true protein
  7. 2545632Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)
  8. 2545639Domain d3gsva1: 3gsv A:1-181 [199461]
    Other proteins in same PDB: d3gsva2, d3gsvb1, d3gsvb2
    automated match to d1x7qa2

Details for d3gsva1

PDB Entry: 3gsv (more details), 1.9 Å

PDB Description: crystal structure of the binary complex between hla-a2 and hcmv nlv- m5q peptide variant
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gsva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsva1 d.19.1.1 (A:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3gsva1:

Click to download the PDB-style file with coordinates for d3gsva1.
(The format of our PDB-style files is described here.)

Timeline for d3gsva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gsva2