SCOPe 2.05: Domain d3g08a2: 3g08 A:186-279

Lineage for d3g08a2 (3g08 A:186-279)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3g08a2: 3g08 A:186-279 [199429]
   Other proteins in same PDB: d3g08a1, d3g08b_
   automated match to d1onqa1
   complexed with fee, nag, plm

Details for d3g08a2

PDB Entry: 3g08, 1.6 Å

PDB Description: crystal structure of the alpha-galactosylceramide analog och in complex with mouse cd1d

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3g08a2:

Sequence, based on SEQRES records:

>d3g08a2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d3g08a2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvphrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqat
ldveageeaglacrvkhsslggqdiilyw

Timeline for d3g08a2:

• d3g08a2 first appeared in SCOPe 2.03
  
• d3g08a2 appears in SCOPe 2.04
  
• d3g08a2 appears in SCOPe 2.06
  
• d3g08a2 appears in the current release, SCOPe 2.08