SCOP 1.65: Domain d1a7nh_: 1a7n H:

Lineage for d1a7nh_ (1a7n H:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (31 PDB entries)

8. Domain d1a7nh_: 1a7n H: [19941]
   Other proteins in same PDB: d1a7nl_
   part of Fv D1.3
   mutant

Details for d1a7nh_

PDB Entry: 1a7n, 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) variant for chain l glu81->asp and chain h leu312->val

SCOP Domain Sequences for d1a7nh_:

Sequence; same for both SEQRES and ATOM records:

>d1a7nh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5}
qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttvtvss

Timeline for d1a7nh_:

• d1a7nh_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7nh_ appears in SCOP 1.63
  
• d1a7nh_ appears in SCOP 1.67
  
• d1a7nh_ appears in the current release, SCOPe 2.08