SCOPe 2.01: Domain d1a7nl_: 1a7n L:

Lineage for d1a7nl_ (1a7n L:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (184 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d1a7nl_: 1a7n L: [19940]
   Other proteins in same PDB: d1a7nh_
   part of Fv D1.3

Details for d1a7nl_

PDB Entry: 1a7n, 2.01 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) variant for chain l glu81->asp and chain h leu312->val

PDB Compounds: (L:) igg1-kappa d1.3 fv (light chain)

SCOPe Domain Sequences for d1a7nl_:

Sequence; same for both SEQRES and ATOM records:

>d1a7nl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpddfgsyycqhfwstprtfgggtkleik

Timeline for d1a7nl_:

• d1a7nl_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7nl_ appears in SCOP 1.75
  
• d1a7nl_ appears in SCOPe 2.02
  
• d1a7nl_ appears in the current release, SCOPe 2.08