Lineage for d1a7nl_ (1a7n L:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363836Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)
  8. 363861Domain d1a7nl_: 1a7n L: [19940]
    Other proteins in same PDB: d1a7nh_
    part of Fv D1.3
    mutant

Details for d1a7nl_

PDB Entry: 1a7n (more details), 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) variant for chain l glu81->asp and chain h leu312->val

SCOP Domain Sequences for d1a7nl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7nl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpddfgsyycqhfwstprtfgggtkleik

SCOP Domain Coordinates for d1a7nl_:

Click to download the PDB-style file with coordinates for d1a7nl_.
(The format of our PDB-style files is described here.)

Timeline for d1a7nl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a7nh_