SCOPe 2.06: Domain d3fb5a2: 3fb5 A:119-219

Lineage for d3fb5a2 (3fb5 A:119-219)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (427 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d3fb5a2: 3fb5 A:119-219 [199396]
   Other proteins in same PDB: d3fb5a1, d3fb5b1, d3fb5b2, d3fb5c_
   automated match to d1r3jb2
   complexed with k

Details for d3fb5a2

PDB Entry: 3fb5, 2.8 Å

PDB Description: kcsa potassium channel in the partially open state with 14.5 a opening at t112

PDB Compounds: (A:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d3fb5a2:

Sequence; same for both SEQRES and ATOM records:

>d3fb5a2 b.1.1.2 (A:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd

Timeline for d3fb5a2:

• d3fb5a2 first appeared in SCOPe 2.03
  
• d3fb5a2 appears in SCOPe 2.05
  
• d3fb5a2 appears in SCOPe 2.07
  
• d3fb5a2 appears in the current release, SCOPe 2.08