![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries) |
![]() | Domain d1kiqa_: 1kiq A: [19938] Other proteins in same PDB: d1kiqc_ |
PDB Entry: 1kiq (more details), 1.85 Å
SCOP Domain Sequences for d1kiqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kiqa_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain} divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleik
Timeline for d1kiqa_: