SCOPe 2.08: Domain d3eo8e1: 3eo8 E:1-218

Lineage for d3eo8e1 (3eo8 E:1-218)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.0: automated matches [191446] (1 protein)
   not a true family

6. Protein automated matches [190672] (32 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [196092] (3 PDB entries)

8. Domain d3eo8e1: 3eo8 E:1-218 [199353]
   Other proteins in same PDB: d3eo8a2, d3eo8b2, d3eo8c2, d3eo8d2, d3eo8e2, d3eo8f2
   automated match to d3eo8f_
   complexed with act, cl, fmn, gol

Details for d3eo8e1

PDB Entry: 3eo8, 1.74 Å

PDB Description: crystal structure of blub-like flavoprotein (yp_001089088.1) from clostridium difficile 630 at 1.74 a resolution

PDB Compounds: (E:) BluB-like flavoprotein

SCOPe Domain Sequences for d3eo8e1:

Sequence; same for both SEQRES and ATOM records:

>d3eo8e1 d.90.1.0 (E:1-218) automated matches {Clostridium difficile [TaxId: 272563]}
melqdtifkrqsvrkfknqdvsdedilkmikaagaapsgkniqnwhfvvikrrdlmekia
dvitkkqqeilvemdkvsvdkanrfrkfvknftlfylkapvlvlvftkvynpsgyyelel
idapketidklfirnpgmqslgaaienftlsaielgygscwltsqnyaadeieavleaet
gfekgeyflgamlalgvpednlkspskkpveeictfik

Timeline for d3eo8e1:

• d3eo8e1 first appeared in SCOPe 2.03, called d3eo8e_
  
• d3eo8e1 appears in SCOPe 2.07