SCOP 1.71: Domain d1g7ia_: 1g7i A:

Lineage for d1g7ia_ (1g7i A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1g7ia_: 1g7i A: [19934]
   Other proteins in same PDB: d1g7ib_, d1g7ic_
   part of Fv D1.3
   complexed with po4; mutant

Details for d1g7ia_

PDB Entry: 1g7i, 1.8 Å

PDB Description: crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3 (vlw92f)

SCOP Domain Sequences for d1g7ia_:

Sequence; same for both SEQRES and ATOM records:

>d1g7ia_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhffstprtfgggtkleik

Timeline for d1g7ia_:

• d1g7ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1g7ia_ appears in SCOP 1.69
  
• d1g7ia_ appears in SCOP 1.73
  
• d1g7ia_ appears in the current release, SCOPe 2.08