Lineage for d3eh4b2 (3eh4 B:41-168)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771160Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)
  8. 2771195Domain d3eh4b2: 3eh4 B:41-168 [199329]
    Other proteins in same PDB: d3eh4a_, d3eh4b1, d3eh4c_
    automated match to d1ehkb1
    complexed with bng, cu1, cua, has, hem

Details for d3eh4b2

PDB Entry: 3eh4 (more details), 2.9 Å

PDB Description: structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3eh4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eh4b2 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

SCOPe Domain Coordinates for d3eh4b2:

Click to download the PDB-style file with coordinates for d3eh4b2.
(The format of our PDB-style files is described here.)

Timeline for d3eh4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eh4b1