![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.0: automated matches [227239] (1 protein) not a true family |
![]() | Protein automated matches [226999] (2 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries) |
![]() | Domain d3eh4b1: 3eh4 B:3-40 [199328] Other proteins in same PDB: d3eh4a_, d3eh4b2, d3eh4c_ automated match to d1ehkb2 complexed with bng, cu1, cua, has, hem |
PDB Entry: 3eh4 (more details), 2.9 Å
SCOPe Domain Sequences for d3eh4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eh4b1 f.17.2.0 (B:3-40) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dqhkahkailayekgwlafslamlfvfialiaytlath
Timeline for d3eh4b1: