Lineage for d3e9nb_ (3e9n B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846644Species Corynebacterium glutamicum [TaxId:1718] [188585] (2 PDB entries)
  8. 2846651Domain d3e9nb_: 3e9n B: [199318]
    automated match to d3e9nd_

Details for d3e9nb_

PDB Entry: 3e9n (more details), 2.4 Å

PDB Description: crystal structure of a putative short-chain dehydrogenase/reductase from corynebacterium glutamicum
PDB Compounds: (B:) putative short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d3e9nb_:

Sequence, based on SEQRES records: (download)

>d3e9nb_ c.2.1.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
kiavvtgatggmgieivkdlsrdhivyalgrnpehlaalaeiegvepiesdivkevleeg
gvdklknldhvdtlvhaaavardttieagsvaewhahldlnvivpaelsrqllpalraas
gcviyinsgagngphpgntiyaaskhalrgladafrkeeanngirvstvspgptntpmlq
glmdsqgtnfrpeiyiepkeianairfvidagettqitnvdvrpri

Sequence, based on observed residues (ATOM records): (download)

>d3e9nb_ c.2.1.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
kiavvtgatggmgieivkdlsrdhivyalgrnpehlaalaeiegvepiesdivkevleeg
gvdklknldhvdtlvhaasvaewhahldlnvivpaelsrqllpalraasgcviyinntiy
aaskhalrgladafrkeeanngirvstvspiepkeianairfvidagettqitnvdvrpr
i

SCOPe Domain Coordinates for d3e9nb_:

Click to download the PDB-style file with coordinates for d3e9nb_.
(The format of our PDB-style files is described here.)

Timeline for d3e9nb_: