Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Mouse (Mus musculus), H-2M10 [TaxId:10090] [160077] (2 PDB entries) |
Domain d3e6ha1: 3e6h A:2-181 [199315] Other proteins in same PDB: d3e6ha2, d3e6hb_ automated match to d1zs8a2 |
PDB Entry: 3e6h (more details), 2.1 Å
SCOPe Domain Sequences for d3e6ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e6ha1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2M10 [TaxId: 10090]} shslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeywe retrrakgneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydgc dyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatllr
Timeline for d3e6ha1: